PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G01220.1
Common NameATHB20, ATHB-20, HB20, T4P13.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 286aa    MW: 33075.8 Da    PI: 5.9787
Description homeobox protein 20
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G01220.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.51.9e-1788140456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  + +++ eq+++Le+ Fe  +++  e++ +LAk lg++ rq+ +WFqNrRa++k
  AT3G01220.1  88 KKRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWK 140
                  4457889*********************************************9 PP

2HD-ZIP_I/II122.42.2e-3986177192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekk+rl+ eqvk+LE+sFe  +kLeperK +la++Lg+qprq+a+WFqnrRAR+kt+qlE+dy++Lk+++++lk++n++L + +++L +e++
  AT3G01220.1  86 EKKKRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVM 177
                  69*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.11582142IPR001356Homeobox domain
SuperFamilySSF466892.69E-1884144IPR009057Homeodomain-like
SMARTSM003894.6E-1685146IPR001356Homeobox domain
CDDcd000862.29E-1587143No hitNo description
PfamPF000461.2E-1488140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-1890150IPR009057Homeodomain-like
PRINTSPR000313.1E-5113122IPR000047Helix-turn-helix motif
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5122138IPR000047Helix-turn-helix motif
PfamPF021838.2E-13143182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000017anatomyvascular leaf primordium
PO:0000036anatomyleaf vascular system
PO:0000230anatomyinflorescence meristem
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0001078developmental stageplant embryo cotyledonary stage
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MYVFDPTTEA GLRLEMAFPQ HGFMFQQLHE DNSQDQLPSC PPHLFNGGGN YMMNRSMSLM  60
NVQEDHNQTL DEENLSDDGA HTMLGEKKKR LQLEQVKALE KSFELGNKLE PERKIQLAKA  120
LGMQPRQIAI WFQNRRARWK TRQLERDYDS LKKQFESLKS DNASLLAYNK KLLAEVMALK  180
NKECNEGNIV KREAEASWSN NGSTENSSDI NLEMPRETIT THVNTIKDLF PSSIRSSAHD  240
DDHHQNHEIV QEESLCNMFN GIDETTPAGY WAWSDPNHNH HHHQFN
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible259274_at0.0
Expression AtlasAT3G01220-
AtGenExpressAT3G01220-
ATTED-IIAT3G01220-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 day after germination (DAG) in first rosette leaf primordia around the veins in the apical part of the leaf and close to the midvein in the basal part of the leaf. At later stage, expressed in new forming veins, and veins and fascicular cambium of mature leaves. {ECO:0000269|PubMed:12644682}.
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein. Expressed during seed germination in the micropylar endosperm and in the root cap, and increases ABA sensitivity and seed dormancy when mutated.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. ATHB20 is expressed during seed germination in the micropylar endosperm and in the root cap, and increases ABA sensitivity and seed dormancy when mutated.
    [PMID: 19947978]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G01220.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8LAT0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G01220
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2288900.0AK228890.1 Arabidopsis thaliana mRNA for putative homeobox-leucine zipper protein, complete cds, clone: RAFL16-20-K05.
GenBankAY0876310.0AY087631.1 Arabidopsis thaliana clone 3722 mRNA, complete sequence.
GenBankBT0292210.0BT029221.1 Arabidopsis thaliana At3g01220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186771.10.0homeobox-leucine zipper protein ATHB-20
SwissprotQ8LAT00.0ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLD7LAH80.0D7LAH8_ARALL; ATHB20
STRINGAT3G01220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Mattsson J,Ckurshumova W,Berleth T
    Auxin signaling in Arabidopsis leaf vascular development.
    Plant Physiol., 2003. 131(3): p. 1327-39
    [PMID:12644682]
  3. Sahr T,Voigt G,Paretzke HG,Schramel P,Ernst D
    Caesium-affected gene expression in Arabidopsis thaliana.
    New Phytol., 2005. 165(3): p. 747-54
    [PMID:15720685]
  4. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  5. Juenger TE, et al.
    Natural genetic variation in whole-genome expression in Arabidopsis thaliana: the impact of physiological QTL introgression.
    Mol. Ecol., 2006. 15(5): p. 1351-65
    [PMID:16626458]
  6. Barrero JM, et al.
    Gene expression profiling identifies two regulatory genes controlling dormancy and ABA sensitivity in Arabidopsis seeds.
    Plant J., 2010. 61(4): p. 611-22
    [PMID:19947978]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]